-13%
АнтиТаро. Математика и Душа. Таро - хороший советчик (комплект из 2 книг + колода из 40 карт)

АнтиТаро. Математика и Душа. Таро - хороший советчик (комплект из 2 книг + колода из 40 карт)

-Вес: 665
-Ширина упаковки: 150
-Высота упаковки: 50
-Глубина упаковки: 220
-crossborder: False

Более подробную информацию о книгах, вошедших в комплект, вы сможете узнать, пройдя по ссылкам: \"АнтиТаро Мистера Фримена. Трансформационные карты (набор из 40 карт)\" \"Математика и Душа. Числовой символизм в магии, астрологии и психологии\" \"Таро - хороший советчик. 24 ключа к толкованию 78 карт\"

Товары из категории математика 40
Напиши магическое письмо Вселенной, и оно поможет тебе обрести деньги

Напиши магическое письмо Вселенной, и оно поможет тебе обрести деньги

-Вес: 100
-Ширина упаковки: 130
-Высота упаковки: 10
-Глубина упаковки: 200
-crossborder: False

О так называемых письмах счастья хоть раз в жизни да слышал каждый. Обычно подобное послание обнаруживается в почтовом ящике, и оно обещает вам счастье, но только при условии, что вы перепишете текст несколько раз и разошлете другим адресатам.

Многие ошибочно принимают подобные письма за розыгрыши или за суеверия. Но письма счастья действительно существуют! Много веков странствуют они по земле, принося удачу и процветание, исполняя.

.

Я вижу будущее, а он нет. Советы экстрасенса о том, как найти настоящую любовь

Я вижу будущее, а он нет. Советы экстрасенса о том, как найти настоящую любовь

-Вес: 400
-Ширина упаковки: 120
-Высота упаковки: 20
-Глубина упаковки: 240
-crossborder: False

Я посвящаю эту книгу женщинам, потому что я сама женщина, и прекрасно понимаю наши проблемы. Я экстрасенс во втором поколении, специалист по гаданию на картах Таро и провожу личные консультации в области любовных отношений уже более тридцати лет.

Четыре части этой книги посвящены разным аспектам отношений - от поиска любви до решения о расставании. Как экстрасенс, я понимаю, как важно уметь прислушиваться к своей интуиции, чтобы.

.

Целостный взгляд на историю Таро. Как использовать, создавать и интерпретировать карточные расклады

Целостный взгляд на историю Таро. Как использовать, создавать и интерпретировать карточные расклады

-Вес: 329
-Ширина упаковки: 185
-Высота упаковки: 10
-Глубина упаковки: 235
-crossborder: False

Книга Джеймса Риклефа - признанного специалиста по Таро, бывшего члена правления Американской Ассоциации Таро, лектора ежегодного симпозиума по Таро в Лос-Анджелесе - посвящена карточным раскладам, их использованию, созданию и интерпретации. Автор убежден, что научиться создавать свои собственные расклады совершенно не сложно и под силу любому желающему. На примере тридцати двух уникальных раскладов, которые автор создал.

Тайна Туринской Плащаницы. Новые научные данные

Тайна Туринской Плащаницы. Новые научные данные

-Вес: 320
-Ширина упаковки: 130
-Высота упаковки: 18
-Глубина упаковки: 210
-crossborder: False

В этой книге собраны все имеющиеся на сегодняшний день данные о Туринской Плащанице - древнем льняном полотнище, на котором загадочным образом отпечаталось изображение мужского тела. Кто же он, этот таинственный Человек на Плащанице?

Самый современный сонник

Самый современный сонник

-Вес: 270
-Ширина упаковки: 100
-Высота упаковки: 20
-Глубина упаковки: 140
-crossborder: False

Новый семейный сонник раскроет тайны ваших снов и станет надежным путеводителем в таинственном и увлекательном мире сновидений.

Богословский анализ лжеучений \

Богословский анализ лжеучений \"Богородничного центра\"

-Вес: 45
-Ширина упаковки: 140
-Высота упаковки: 5
-Глубина упаковки: 200
-crossborder: False

Богословский анализ лжеучений \"Богородничного центра\"

Серия \

Серия \"Путь мистика\" (комплект из 4 книг)

-Вес: 1950
-Ширина упаковки: 160
-Высота упаковки: 90
-Глубина упаковки: 220
-crossborder: False

Более подробную информацию о книгах, вошедших в комплект, вы сможете узнать, пройдя по ссылкам: \"Великий секрет. Беседы по песням Кабира\" , \"Дети Вселенной.

Как оставаться человечным в расколотом мире. Беседы по \"Дезидератам\"\" , \"За пределами просветления\" , \"Притчи старого города.

Беседы о свободе, любви, счастье и юморе\" . .

Таро. Происхождение, значение и использование карт

Таро. Происхождение, значение и использование карт

-Вес: 185
-Ширина упаковки: 146
-Высота упаковки: 20
-Глубина упаковки: 215
-crossborder: False

Еще одно оригинальное исследование классического таро. Особой ценностью этой книги являются иллюстрации, взятые из редких древних колод, исторические сведения и, наконец, - то, что вы не найдете нигде, - подробности правил классической игры в Тарок.

1 363 ₽
1 029 ₽
OZON.RU
В поисках утраченных смыслов. Духовные начала цивилизации

В поисках утраченных смыслов. Духовные начала цивилизации

-Вес: 455
-Ширина упаковки: 150
-Высота упаковки: 20
-Глубина упаковки: 225
-crossborder: False

Научное обоснование существования Творца раскрытие смысла понятий \"Красота\", \"Любовь\" и других первоэлементов Бытия, объяснение феноменальных явлений (мироточение икон, самопроизвольная очистка куполов, икон и крестов, жизнь без еды и воды), выявление роли и предназначения человечества в эволюции Вселенной — в этой книге. Ее автор — доктор технических наук, профессор, академик РАЕН, заведующий кафедрой МАИ Управления и.

История тайных обществ, союзов и орденов

История тайных обществ, союзов и орденов

-Вес: 480
-Ширина упаковки: 140
-Высота упаковки: 50
-Глубина упаковки: 210
-crossborder: False

Интерес к таинственному, стремление познать непознанное было присуще человеку на всем протяжении его истории. Оно обернулось появлением множества тайных союзов религиозного, этического, политического характера. Их истории, начиная с древнейших времен, и посвящена эта книга.

Я вижу будущее, а он нет. Любовная нумерология. Даосские секреты (комплект из 3-х книг)

Я вижу будущее, а он нет. Любовная нумерология. Даосские секреты (комплект из 3-х книг)

-Вес: 990
-Ширина упаковки: 150
-Высота упаковки: 70
-Глубина упаковки: 220
-crossborder: False

В данный комплект входят книги: 1. Я вижу будущее, а он нет 2. Любовная нумерология 3. Даосские секреты

1 913 ₽
1 493 ₽
OZON.RU
Йога-практики. Йога-начни. Исцеляющая энергия (комплект из 3 книг)

Йога-практики. Йога-начни. Исцеляющая энергия (комплект из 3 книг)

-Вес: 800
-Ширина упаковки: 150
-Высота упаковки: 50
-Глубина упаковки: 210
-crossborder: False

Более подробную информацию о книгах, вошедших в комплект, вы сможете узнать, пройдя по ссылкам: \"Йога-практики. Мудры, мантры, медитации\" \"Йога - начни свой путь. Асаны, дыхание, медитации\" \"Исцеляющая энергия камней. Кристаллотерапия для начинающих\"

1 286 ₽
1 004 ₽
OZON.RU
Охотники за привидениями. Проявления потустороннего мира (комплект из 2 книг)

Охотники за привидениями. Проявления потустороннего мира (комплект из 2 книг)

-Вес: 735
-Ширина упаковки: 150
-Высота упаковки: 30
-Глубина упаковки: 220
-crossborder: False

Предлагаем вашему вниманию комплект из 2 книг: Мишель Беланджер \"Охотники за привидениями. Методы защиты при столкновении с паранормальным\" (мягкая обложка, серия \"Практическая парапсихология\") и Вернер Шибелер \"Проявления потустороннего мира.

Свидетельства очевидцев. Результаты экспериментов.

Фоторепортажи с мест событий\" (интегральный переплет, серия \"Психонавтика\"). .

Прогноз на каждый день. 2018 год. Телец

Прогноз на каждый день. 2018 год. Телец

-Вес: 71
-Ширина упаковки: 133
-Высота упаковки: 3
-Глубина упаковки: 203
-crossborder: False

Наверное, нет человека, которого не интересовало бы его будущее. Познакомившись с этой книгой, вы узнаете, какие события ожидают вас в 2018 году, как сложатся дела, какие дни будут благоприятны для различного рода начинаний, какие нет. Также многое узнаете и о себе, о своих чертах характера, здоровье, о том, с каким знаком Зодиака у вас могут сложиться наиболее благоприятные отношения: дружеские, партнерские, брачные.

Чакры в шаманизме

Чакры в шаманизме

-Вес: 345
-Ширина упаковки: 148
-Высота упаковки: 13
-Глубина упаковки: 210
-crossborder: False

Автор познавательной книги #34;Чакры в шаманизме #34; - практикующий шаман и психотерапевт Сюзан Райт, которая на примере собственного жизненного пути показывает взаимосвязь чакральной системы с различными шагами эмоционального и духовного развития человека. Из предлагаемой к прочтению книги читатель узнает о восьми основных этапах человеческой жизни от рождения до смерти, на каждом из которых мы сталкиваемся с вызовами судьбы и.

Практическая черная магия. Кладбищенские методы

Практическая черная магия. Кладбищенские методы

-Вес: 295
-Ширина упаковки: 160
-Высота упаковки: 20
-Глубина упаковки: 220
-crossborder: False

Данную книгу написали украинские авторы для того, чтобы открыть людям, а именно практикам левостороннего пути, тайны и ключи кладбищенских методов в ритуалах черной магии. Черной магией снимаются сильнейшие родовые проклятия, открываются дороги и пути в жизнь, привлекается благополучие и материальные средства, ставятся мощнейшие защиты как на человека, так и на бизнес. Конечно, черной магией можно и навредить, но делать это нужно.

3 083 ₽
2 475 ₽
OZON.RU
Волшебная палочка для будущего миллионера

Волшебная палочка для будущего миллионера

-Вес: 320
-Ширина упаковки: 115
-Высота упаковки: 15
-Глубина упаковки: 211
-crossborder: False

\"Студия благополучия и успеха Наталии Правдиной\" - новая серия книг, издающихся специально по просьбам многочисленной армии последователей и почитателей таланта Наталии Правдиной - создательницы уникальной системы позитивной трансформации сознания, самого известного в России специалиста древнекитайского учения фэншуй, автора бестселлеров, вышедших миллионными тиражами. Каждая книга нашей новой серии поможет Вам освоить.

Астрология трансформации личности. Кармическая астрология и методика коррекции гороскопа

Астрология трансформации личности. Кармическая астрология и методика коррекции гороскопа

-Вес: 410
-Ширина упаковки: 140
-Высота упаковки: 25
-Глубина упаковки: 208
-crossborder: False

Как связаны гороскопы предыдущего и нынешнего воплощения? Как по гороскопу определить кармический опыт натива? Какова роль высших планет, Лунных Узлов, кармических домов? На эти и многие другие вопросы отвечает первая часть книги, подводящая итог уникального исследования прошлых инкарнаций большого количества людей, в котором автор принимал непосредственное участие.Вторая часть посвящена практической работе с картой. Что делать.

1 693 ₽
1 413 ₽
OZON.RU
Астрофизика. Шуньята. Рак глазами физика (комплект из 3 книг)

Астрофизика. Шуньята. Рак глазами физика (комплект из 3 книг)

-Вес: 865
-Ширина упаковки: 160
-Высота упаковки: 40
-Глубина упаковки: 235
-crossborder: False

Более подробную информацию о книгах, вошедших в комплект, вы сможете узнать, пройдя по ссылкам: \"Астрофизика и Каббала. Наука и религия о природе вселенной\" , \"Шуньята. Божественная Пустота и Мистическая Физика\" , \"Рак глазами физика. Механизм возникновения, профилактика, лечение, защита\" .

Жезл ведьмы. Изготовление, история и магические свойства волшебных палочек

Жезл ведьмы. Изготовление, история и магические свойства волшебных палочек

-Вес: 140
-Ширина упаковки: 150
-Высота упаковки: 20
-Глубина упаковки: 240
-crossborder: False

Сегодня образ волшебной палочки стал неотъемлемой частью массовой культуры. Она появляется в книгах и в фильмах гораздо чаще, чем любой другой предмет магического арсенала. Как же нам отделить правду об этом инструменте от неуемной фантазии писателей и кинематографистов? Об этом вы узнаете из книги Альфериана Гвидиона Маклира, мастера по изготовлению волшебных палочек — или жезлов ведьмы, как их обычно называют те, кто их.

Рудольф Штайнер. Каким я его видел и знал

Рудольф Штайнер. Каким я его видел и знал

-Вес: 70
-Ширина упаковки: 120
-Высота упаковки: 5
-Глубина упаковки: 165
-crossborder: False

Впервые автор встретился с Рудольфом Штайнером в 1909 году, будучи студентом в Гейдельберге. Эта встреча оказалась поворотным моментом в его жизни.

С того дня он стал духовным учеником Штайнера - знаменитого осно­воположника антропософии. В 1919 году Р.

Штайнер пригласил автора -в числе первых - преподавать в вальдорфской школе. Их отношения не пре­кращались до конца жизни Р.

Штайнера. Описанные в книге встречи передают обаяние и.

.

Искусство жить и умирать. Ключи к новой жизни (комплект из 9 книг)

Искусство жить и умирать. Ключи к новой жизни (комплект из 9 книг)

-Вес: 1465
-Ширина упаковки: 125
-Высота упаковки: 97
-Глубина упаковки: 200
-crossborder: False

Вашему вниманию предлагается комплект из 9 книг.

2 701 ₽
2 455 ₽
OZON.RU
Основы релаксации

Основы релаксации

-Вес: 215
-Ширина упаковки: 140
-Высота упаковки: 20
-Глубина упаковки: 210
-crossborder: False

\"Основы релаксации\" Тартанга Тулку, известного ламы - это руководство по тибетской оздоровительной системе Кум-Ньяй. Книга знакомит нас с новыми методами ревитализации нашей жизни, пригодные как для молодых, так и для старых.

В часть первую входят теория, массаж и вводные упражнения. Во второй части приведены более сложные движения.

Тартанг Тулку учился в Тибете и в течение десяти лет работал в Индии. Затем он переехал в Соединенные.

.

Дева. Полный гороскоп на 2018 год

Дева. Полный гороскоп на 2018 год

-Вес: 100
-Ширина упаковки: 130
-Высота упаковки: 10
-Глубина упаковки: 205
-crossborder: False

Что такое гороскоп? Это астрономическая визитная карточка, с которой мы приходим в этот мир. Планеты \"задают тон\" мыслям и чувствам, которые определяют наши поступки и нашу судьбу.

Следуйте рекомендациям астролога, и вы, как профессиональный серфингист, \"поймаете волну\", которая доставит вас к берегу исполнения ваших желаний. Интеллигентным и наблюдательным Девам 2018 год принесет хорошие возможности для развития творческих.

.

Как увидеть рай?

Как увидеть рай?

-Вес: 625
-Ширина упаковки: 160
-Высота упаковки: 40
-Глубина упаковки: 220
-crossborder: False

\"Как увидеть Рай?\" - это расширенный вариант издания книги \"Все увидят Ад\", которая была впервые издана в 2006 году. В настоящий момент автору очевидно, что религиозное сознание на русскоязычном постсоветском пространстве уже завершает стадию \"детства\", очень бурно ускорившую рост сразу после развала атеистического Советского Союза, и входит в новую - стадию \"юношества\", когда начинает ощущаться разумение и осмысление окружающего.

Пробуждение сознания (комплект из 3 книг)

Пробуждение сознания (комплект из 3 книг)

-Вес: 1420
-Ширина упаковки: 140
-Высота упаковки: 80
-Глубина упаковки: 210
-crossborder: False

2 094 ₽
1 902 ₽
OZON.RU
Я иду по Гималаям. Чудеса и тайны великого перехода

Я иду по Гималаям. Чудеса и тайны великого перехода

-Вес: 341
-Ширина упаковки: 130
-Высота упаковки: 10
-Глубина упаковки: 178
-crossborder: False

\"В Гималаях, на больших высотах человек переносится в мир Живого Света, попадает в пятое измерение. Сознание, тело, душа наполняются Светом, Всепроницающей Любовью, Великой Свободой.

И может казаться, что человек уже освоил пятое измерение. На самом деле это был только аванс, потому как еще нужно работать над собой: прорабатывать негативные коды, стремиться к новым измерениям.

Ибо, как говорили древние, \"Высшее в низшем\", что означало:.

Вы Боги

Вы Боги

-Вес: 655
-Ширина упаковки: 150
-Высота упаковки: 25
-Глубина упаковки: 224
-crossborder: False

\"Среди посланников Бога Иисус был первым, кто совершил самый большой переворот. Он был первым, кто нарушил все старые обычаи; и Его распяли на кресте за то, что Он осмелился сказать, что Он Сын Божий и все люди также являются сыновьями и дочерьми Бога. Настойчивость, с которой Иисус подчёркивал божественное происхождение человека, до такой степени возмущала и раздражала книжников и фарисеев, что они однажды попытались забросать его.

Беседы о Гераклите. Тайный смысл древней философии(комплект из 2 книг)

Беседы о Гераклите. Тайный смысл древней философии(комплект из 2 книг)

-Вес: 1225
-Ширина упаковки: 160
-Высота упаковки: 60
-Глубина упаковки: 230
-crossborder: False

Обращаем ваше внимание на то, что в комплект входят две одинаковые книги.О Гераклите написано одновременно много и очень мало.

Мудрый древнегреческий философ изъяснялся столь сжато и многозначно, что многие его афоризмы, часто напоминающие фольклорные загадки или изречения оракула, так и остались непонятыми. Гераклит Темный, Загадочный, Непонятный - так о нем до сих пор говорят люди.

В этой книге Ошо открывает тайну высказываний.

Книга о вечной жизни. Сестра моя смерть

Книга о вечной жизни. Сестра моя смерть

-Вес: 320
-Ширина упаковки: 150
-Высота упаковки: 25
-Глубина упаковки: 210
-crossborder: False

Новые методы реанимации позволили ученым приоткрыть завесу над тайной смерти и увидеть немного больше, чем было возможно до сих пор. Оказывается, смерть тела - еще не конец существования личности. Главная часть человека - душа - покидает умершее тело и продолжает жить в новых условиях.

Курс практической хиромантии. О характере и типе личности - по руке

Курс практической хиромантии. О характере и типе личности - по руке

-Вес: 558
-Ширина упаковки: 195
-Высота упаковки: 15
-Глубина упаковки: 274
-crossborder: False

Хиромантия - одна из древнейших наук. Искусство чтения по руке требует внимания к деталям и таланта толкователя.

Книга Г.Хюрлиманн поможет тем, кто хочет овладеть этим искусством.

В ней собраны сведения о всех линиях, расположенных на ладонях человека, об их сочетаниях и влиянии этих линий на судьбу и характер. Даже форма кистей рук многое может рассказать о собеседнике.

Соединение значений линий ладони и гороскопа поможет лучше.

Свобода и покой

Свобода и покой

-Вес: 80
-Ширина упаковки: 130
-Высота упаковки: 5
-Глубина упаковки: 210
-crossborder: False

Каждый из нас приходит в этот мир не просто так, но никто заранее не знает своей судьбы. Каждая жизнь имеет ценность, каждая душа несет свет.

Иногда он тих, слаб и виден только самым близким. Но иногда случаются вспышки столь яркие, что освещают путь не только самому человеку, но и тысячам людей, идущих за ним следом.

Шри Чинмою - индийскому философу, музыканту, спортсмену, мастеру йоги и медитации - была уготована именно такая дорога. Он.

.

Искусство предвидеть будущее и управлять своей судьбой

Искусство предвидеть будущее и управлять своей судьбой

-Вес: 170
-Ширина упаковки: 135
-Высота упаковки: 20
-Глубина упаковки: 215
-crossborder: False

Тысячи людей изучают различные технологии управления реальностью, однако по-настоящему изменить свою жизнь дается считанным единицам. Почему? Почему широко рекламируемые техники не дают желаемого результата? Почему предлагаемые «гуру» схемы не работают? Да просто потому, что в жизни нет шаблонов и схем! Большинство же технологий пытаются научить вас «управлять реальностью», исходя из статичности Мира. Это просто.

Как стать экстрасенсом Полное практическое пособие том 3

Как стать экстрасенсом Полное практическое пособие том 3

-Вес: 300
-Ширина упаковки: 170
-Высота упаковки: 10
-Глубина упаковки: 240
-crossborder: False

Каждый из нас с рождения имеет невероятные экстрасенсорные способности. К сожалению, у большинства эти способности заглушались внешней средой, ложными установками и даже собственными родителями и близкими.

Мы живем в очень интересном сложном мире, но из за ограниченных возможностей наших чувств, мы очень многое не видим и не понимаем. Экстрасенсорные возможности раздвигают занавес невежества, раскрывают чудесные глубины тайн.

.

Ты экстрасенс: развивайте природную интуицию через свой психотип

Ты экстрасенс: развивайте природную интуицию через свой психотип

-Вес: 480
-Ширина упаковки: 140
-Высота упаковки: 30
-Глубина упаковки: 210
-crossborder: False

АннотацияИз книги Шерри Диллард — медиума с 20-летним стажем вы узнаете, как раскрыть в себе экстрасенсорный дар и научиться слышать голос своей интуиции. Автор выделяет четыре психотипа, которые определяют, по какому каналу интуитивного восприятия вы получаете экстрасенсорную информацию. Она может приходить в виде мысленных образов, различных эмоций, ощущений в физическом теле или через осознание изменений в окружающем вас.

Fourteen Days To Light, Hope, and Healing

Fourteen Days To Light, Hope, and Healing

-Вес: 218
-Ширина упаковки: 191
-Высота упаковки: 5
-Глубина упаковки: 235
-crossborder: False

You know what they say about change: #34;Nothing is ever going to change until something changes. #34; We are all looking for the change that makes us a little better.

That change starts on the inside, in our hearts and in our minds. Fourteen Days to Light, Hope, and Healing is the tool that you need to begin making those changes possible.

Most successful people who discover light, hope, and healing in their lives follow similar patterns, many without realizing it. With years of study and personal experiences, Alicia has discovered what many of these proven patterns are.

The Fourteen-day course is comprised of fourteen principles and steps to get you thinking and feeling in a different way. It is designed to help you overcome the things that are holding you back from seeing real changes.

.

Paradise Reborn. The True Fountain of Youth

Paradise Reborn. The True Fountain of Youth

-Вес: 537
-Ширина упаковки: 152
-Высота упаковки: 229
-Глубина упаковки: 17
-crossborder: False

Throughout the history of mankind people have searched the world over to find the “Fountain of Youth” and have longed to return to paradise and many great books on the subject have been written that have captured the hearts and minds of men and women who dream of finding that magical place and living that ideal and perfect life where everything is serene and you are in perfect peace with everything and everyone around you and all is in perfect harmony. Still today men and women spend hours, days and even years pursuing the illusive dream! This book, “Paradise Reborn” “The True Fountain Of Youth” is an in-depth guide meant to show you all you need to obtain the illusive dream and find “The True Fountain Of Youth” bringing you into perfect balance fitness and health in your.

Contest Charts

Contest Charts

-Вес: 128
-Ширина упаковки: 140
-Высота упаковки: 5
-Глубина упаковки: 216
-crossborder: False

In Contest Charts, Doris Chase Doane shares the secrets of determining winners and losers in a variety of championship contests, including: football and baseball games; political elections; boxing, golf and tennis matches; individual sports; and awards competitions.The author explains, through the use of extensive examples, how to read the chart for the time a question is asked regarding the outcome of the event. In addition, the importance of the timing and wording of the question are explained in detail.

I Know I Am Better Than What I Was Told . . . A Remarkable Way to Break What Holds You from Creating the Life You Want

I Know I Am Better Than What I Was Told . . . A Remarkable Way to Break What Holds You from Creating the Life You Want

-Вес: 152
-Ширина упаковки: 127
-Высота упаковки: 7
-Глубина упаковки: 203
-crossborder: False

This book was written to help you break through the obstacles keep you from reaching your full potential. ~ The traumatic experiences in life that happened to us, do not have to define who we are.

Breaking Free. My spiritual transformation into a psychic medium

Breaking Free. My spiritual transformation into a psychic medium

-Вес: 320
-Ширина упаковки: 140
-Высота упаковки: 216
-Глубина упаковки: 12
-crossborder: False

‘Breaking Free’ is the uplifting story of New Zealander Kerry-Marie Callander’s journey to becoming a sought-after psychic medium. From meeting her spirit protector in childhood through to discovering and developing her psychic gift, Kerry-Marie shares her life experiences and the lessons she has learned through communication with the spirit world. She is known for compassionate readings which are full of love.Kerry-Marie’s inspirational story, which includes teachings from her powerful gift of mediumship, will reassure you of the spirit world’s existence and provide comforting evidence of life after death.

The Qabalah. Beyond the Veil

The Qabalah. Beyond the Veil

-Вес: 172
-Ширина упаковки: 152
-Высота упаковки: 6
-Глубина упаковки: 229
-crossborder: False

The Qabalah has long been a system of mysticism and magic that few could truly understand, thanks to the difficult and obtuse language and symbolism employed. Many texts have appeared, offering to explain this mysterious subject, but few do so as succintly as this book.The Qabalah: Beyond the Veil aims to lift the lid on this extraordinary tradition, utilised by Jews, Christians and Hermeticists. It provides a brief look at the primary aspects of the system, from the Sephiroth and Paths on the Tree of Life to the Lightning Flash and those most impenetrable of all veils: those of Negative Existence itself.

Mediumship. A Course of Seven Lectures: Delivered at the Mount Pleasant Park Camp-Meeting, During the Month of August, 1888. Also, a Lecture On the Perpetuity of Spiritualism, Given at the Same Place, On the Last Sunday of the Camp-Meeting

Mediumship. A Course of Seven Lectures: Delivered at the Mount Pleasant Park Camp-Meeting, During the Month of August, 1888. Also, a Lecture On the Perpetuity of Spiritualism, Given at the Same Place, On the Last Sunday of the Camp-Meeting

-Вес: 418
-Ширина упаковки: 156
-Высота упаковки: 13
-Глубина упаковки: 234
-crossborder: False

This work has been selected by scholars as being culturally important and is part of the knowledge base of civilization as we know it.This work is in the public domain in the United States of America, and possibly other nations.

Within the United States, you may freely copy and distribute this work, as no entity (individual or corporate) has a copyright on the body of the work.Scholars believe, and we concur, that this work is important enough to be preserved, reproduced, and made generally available to the public.

To ensure a quality reading experience, this work has been proofread and republished using a format that seamlessly blends the original graphical elements with text in an easy-to-read typeface.We appreciate your support of the preservation process, and thank you for being an.

.

The Health Guide. Aiming at a Higher Science of Life and the Life-Forces; Giving Nature.s Simple and Beautiful Laws of Cure

The Health Guide. Aiming at a Higher Science of Life and the Life-Forces; Giving Nature.s Simple and Beautiful Laws of Cure

-Вес: 312
-Ширина упаковки: 156
-Высота упаковки: 10
-Глубина упаковки: 234
-crossborder: False

This work has been selected by scholars as being culturally important and is part of the knowledge base of civilization as we know it.This work is in the public domain in the United States of America, and possibly other nations.

Within the United States, you may freely copy and distribute this work, as no entity (individual or corporate) has a copyright on the body of the work.Scholars believe, and we concur, that this work is important enough to be preserved, reproduced, and made generally available to the public.

To ensure a quality reading experience, this work has been proofread and republished using a format that seamlessly blends the original graphical elements with text in an easy-to-read typeface.We appreciate your support of the preservation process, and thank you for being an.

.

Returning to the Void. Papa Joe, Maori Healing #and# Sacred Teachings

Returning to the Void. Papa Joe, Maori Healing #and# Sacred Teachings

-Вес: 272
-Ширина упаковки: 140
-Высота упаковки: 10
-Глубина упаковки: 216
-crossborder: False

Returning to the Void came into manifestation per the request of Hohepa Delamere, alias Papa Joe, who is a widely known and highly respected Maori elder and healer from New Zealand. Together with other healers he came to the USA and also to Europe to help ople outside his home soil.

Their tremendous success abroad has been a result of successfully addressing the whole being instead of just treating symptoms, and in that way, achieving hundreds of #34;miracle healings #34;.In June 2005 Papa Joe met Iris Loesel in California and asked her to help preserve Maori knowledge by writing about it.

Iris, who was new to Maori healing, was given a spiritual transfer of knowledge by Papa Joe and by that was enabled to channel this book. The final text was read and approved by Papa Joe.

This is the.

ANIMALS #and# MEN - ISSUES 1 - 5 - IN THE BEGINNING

ANIMALS #and# MEN - ISSUES 1 - 5 - IN THE BEGINNING

-Вес: 341
-Ширина упаковки: 156
-Высота упаковки: 11
-Глубина упаковки: 234
-crossborder: False

At the beginning of the 21st Century monsters still roam the remote, and sometimes not so remote, corners of our planet. It is our job to search for them.

The Centre for Fortean Zoology [CFZ] is the only professional, scientific and full-time organisation in the world dedicated to cryptozoology - the study of unknown animals. Since 1992 the CFZ has carried out an unparalleled programme of research and investigation all over the world.

We have carried out expeditions to Sumatra (2003 and 2004), Mongolia (2005), Puerto Rico (1998 and 2004), Mexico (1998), Thailand (2000), Florida (1998), Nevada (1999 and 2003), Texas (2003 and 2004), and Illinois (2004). Since 1994 we have been publishing the world #39;s only dedicated cryptozoology magazine Animals amp; Men.

This volume contains fascimile.

Das atmende Leben

Das atmende Leben

-Вес: 191
-Ширина упаковки: 127
-Высота упаковки: 8
-Глубина упаковки: 203
-crossborder: False

Der Atem ist eines der vielleicht größten Geheimnisse überhaupt. Wenn wir uns unseres Atems bewusst werden, erhalten wir die Fähigkeit, tief greifende Veränderungen hervorzurufen: in unserem Körper, unserem Geist und unseren Sinnen, aber auch in unserer unmittelbaren Umwelt.

Was ist dieser Atem, der den Grund legt für das Wunder des Lebens?In diesem Klassiker der Atem-Literatur gibt Reshad Feild, der bekannte englische Mystiker, spirituelle Lehrer und Bestsellerautor ( #34;Ich ging den Weg des Derwisch #34;) wertvolle Gedankenanstöße und Übungsanleitungen zur Beleuchtung dieser zeitlosen, existenziellen Fragestellung.Einen bewussten Atemzug zu tun, heißt, die Verantwortung zu übernehmen für diesen einen gegenwärtigen Augenblick - diesen einzigen Moment, der uns wirklich zur.

.

Roger Garaudy - Biographie des 20. Jahrhunderts

Roger Garaudy - Biographie des 20. Jahrhunderts

-Вес: 515
-Ширина упаковки: 148
-Высота упаковки: 19
-Глубина упаковки: 210
-crossborder: False

Als einer der größten Denker unserer Zeit, folgte Roger Garaudy mit Vehemenz dem Ideal „einer humanen Ordnung für die Menschen #34;. Um dieses Ziel zu erreichen, setzte er sein vielfältiges Wissen dafür ein, das von der Philosophie bis hin zur Kunst reichte.

Er war dermaßen von diesem Ideal durchdrungen, dass er zugunsten seiner Vision sogar sein eigenes Leben zu opfern bereit war.In diesem Werk zeichnet Roger Garaudy das farbenfrohe und kritische Bild der Philosophie und der Ideenwelt des 20.

Jahrhunderts. Er hinterfragt alle philosophischen Strömungen dieser Epoche - darunter die Philosophen und Intellektuellen - bis ins kleinste Detail.

Dabei geht er im Kern folgenden Fragen nach: Welchen Gewinn und Verlust haben die philosophischen Strömungen des 20. Jahrhunderts der.

.

Bioenergetisches  Informationsmanagement

Bioenergetisches Informationsmanagement

-Вес: 186
-Ширина упаковки: 148
-Высота упаковки: 7
-Глубина упаковки: 210
-crossborder: False

Eine Einführung in das Bioenergetische Informationsmanagement Die eigene Kraft, Energie und Befindlichkeit selbst steuern? Zu schön, um wahr zu sein. Schließlich gibt es eine Menge innere und äußere Einflüsse, die sich unserer Kontrolle entziehen, oder?Heiko Wenner, Baubiologe, Energiearbeiter und Heiler hat sich ein Leben lang mit diesem Thema auseinandergesetzt.

In seinen Forschungen beschäftigte er sich mit Lebensenergie, mit Energieübertragung und mit den Selbstheilungskräften des Menschen. Seine Erkenntnis: Alles ist Schwingung.

Und jede Schwingung hat ihre ganz spezifische Frequenz. Wenn Störungen und Blockaden im Energiefluss des Organismus auftreten, äußert sich dies in dysharmonischen Schwingungsmustern.

Diese Frequenzen müssen neu in-Form-iert werden. Diese.

.

Marrakesch

Marrakesch

-Вес: 164
-Ширина упаковки: 148
-Высота упаковки: 6
-Глубина упаковки: 210
-crossborder: False

In diesen Reiseaufzeichnungen über seinen Aufenthalt in der Medina von Marrakesch gewährt uns der Autor Einblicke in das soziale und religiöse Leben ihrer Bewohner und ihre, uns vielfach fremd anmutenden, Leben- und Verhaltensweisen. Abseits romantischer Verklärungen zeichnet er ein Bild des Orients, das, neben freudigen Momenten, vom harten Alltag der einfachen Menschen und ihrem täglichen Kampf ums Überleben geprägt ist.

Einfühlsam, mit Ironie und stets mit einem Augenzwinkern schildert Christian Thomas Wolff seine Beobachtungen und Begegnungen mit Marrakschis, Händlern und Reisenden. Dabei bedient er sich einer Erzählweise, die von einer wohltuenden Sachlichkeit geprägt ist - auch wenn er selbst von Geschehnissen betroffen war.

Kaum merklich erlebt der Autor Veränderungen.

Erfullung

Erfullung

-Вес: 274
-Ширина упаковки: 148
-Высота упаковки: 10
-Глубина упаковки: 210
-crossborder: False

„Erfüllung -Mach das Unmögliche möglich #34; ist die Quintessenz einer über 35 jährigen Erfahrung als Hypnotherapeut und Coach. In diesen Jahren hat sich das physikalisch-wissenschaftliche Weltbild dramatisch verändert und auch die Wege für die seelisch-geistige Befreiung des Menschen.

Das Buch vermittelt die Grundlagen mit denen eine Bewusstseinsveränderung heute erreicht werden kann. Es liefert einen neuen Rahmen, um den Wesenskern des Menschen zu offenbaren.

Dabei führt es den Leser zu seinen begrenzenden Glaubenssystemen und eröffnet ihm Methoden sich dauerhaft von ihnen zu befreien. Hier ist ein erprobter, spiritueller Weg für inneres Wachstum beschrieben, der über alle wissenschaftlichen Aspekte transzendiert.

Der Autor schreibt:„Um Erfüllung in deinem Leben zu.

Далее >>>